IGF‑1LR3
This is a demonstration store. You can purchase products like this from Versed.
Lyophilized IGF‑1LR3 Powder
Overview
Insulin‑like Growth Factor‑1 Long Arg3 (IGF‑1LR3) is a synthetic analog of native IGF‑1 engineered for extended activity and enhanced potency in research applications. By substituting arginine at position 3 and adding 13 amino acids at the N‑terminus, IGF‑1LR3 resists binding protein sequestration and proteolysis, resulting in a half‑life of 20–30 hours versus 12–15 minutes for natural IGF‑1 Wikipedia. It retains full agonist activity at the IGF‑1 receptor to promote anabolic and mitogenic signaling, making it ideal for studies in muscle biology, metabolic regulation, and cell survival pathways PMC.
Key Features
-
Extended Half‑Life & Potency
The N‑terminal extension and Arg³ substitution increase metabolic stability and reduce IGFBP affinity, boosting potency roughly threefold over native IGF‑1 with a circulating half‑life of 20–30 hours Wikipedia Swolverine. -
Anabolic & Mitogenic Activity
Activates the IGF‑1 receptor to stimulate PI3K‑Akt and MAPK pathways, driving protein synthesis, cell proliferation, and survival in muscle and non‑muscle cell models PMC. -
Low Binding to IGFBPs
Reduced affinity for IGF‑binding proteins ensures more free peptide available to engage receptors, enhancing bioactivity in vitro and in vivo assays Wikipedia. -
Versatile Delivery
Supplied as a sterile, lyophilized powder that reconstitutes easily in aqueous buffer; suitable for subcutaneous injection, infusion pumps, or formulation into controlled‑release systems Swolverine. -
High Purity & Quality Control
Verified ≥ 99 % purity by reverse‑phase HPLC and mass spectrometry; manufactured under cGMP‑equivalent conditions to ensure batch‑to‑batch consistency Qkine.
Research Applications
-
Muscle Growth & Regeneration
Model IGF‑1–mediated myoblast differentiation, protein synthesis, and recovery after injury in cell culture and rodent models PMC LIVV. -
Metabolic & Aging Studies
Investigate IGF‑1 LR3’s effects on glucose uptake, insulin sensitivity, and age‑related decline in mitochondrial function LIVV. -
Stem Cell Maintenance
Support proliferation and pluripotency in human stem cell cultures, reducing differentiation and apoptosis Qkine. -
Neuroprotection & Cognitive Research
Explore IGF‑1 signaling in models of neurodegeneration, synaptic plasticity, and neuronal survival under stress PMC. -
Cancer Biology & Signal Transduction
Examine mitogenic signaling, receptor trafficking, and downstream gene expression in tumor and normal cell lines PubMed.
Specifications
Attribute | Specification |
---|---|
Form | White to off‑white lyophilized powder |
Sequence | MFPAMPLSSH LFVNGPRTL CGAPGELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (Wikipedia) |
Purity | ≥ 99 % by reverse‑phase HPLC |
Molecular Weight | ~9.4 kDa |
Half‑Life | ≈ 20–30 hours (Wikipedia) |
CAS Number | 143045‑27‑6 (Wikipedia) |
Solubility | ≥ 5 mg/mL in water @ 25 °C |
Storage | –20 °C, dry, protected from light |

Revitalize
Inspiring Wellness
Balance
Exceptional Purity, Exceptional Potential
Recommended Products